20% OFF shipping at www.lodomez-construction.com on orders over $79 + up to 10% OFF products
www.lodomez-construction.com
home > TREM2 Polyclonal Antibody-BZ17066 > TREM2 Polyclonal Antibody-BZ17066
download picture
TREM2 Polyclonal Antibody-BZ17066TREM2 Polyclonal Antibody Sizes: 50l, 100l Catalogue Numbers: BZ17066 50, BZ17066 100 Product: Liquid in PBS containing 50% glycerol, 0. 5% BSA and 0. 02% sodium azide, pH 7. 3. Swiss Prot: Q9NZC2 Host: Rabbit Reactivity: Human, Mouse, Rat Applications: WB, IHC P, ICC IF All Applications: WB: 1 500 1 1000 IHC: 1 50 1 100 IF: 1 50 1 200 Background: This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein
Shopping security

Shopping security

Each payment you make on thelockerguy is secured with strict SSL encryption and PCI DSS data protection protocols

TREM2 Polyclonal Antibody

Sizes: 50µl, 100µl

Catalogue Numbers: BZ17066-50, BZ17066-100

Product: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide, pH 7.3.

Swiss-Prot: Q9NZC2

Host: Rabbit

Reactivity: Human, Mouse, Rat

Applications: WB, IHC-P, ICC/IF

All Applications: WB: 1/500-1/1000 IHC: 1/50-1/100 IF: 1/50-1/200

Background: This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production of constitutive inflammatory cytokines. Defects in this gene are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL). Alternative splicing results in multiple transcript variants encoding different isoforms.

Purification and Purity: Affinity Purified

Storage and Stability: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Specificity: IgG

Bioworld Molecular Weight: Calculated MW: 25 kDa; Observed MW: 25,35-50 kDa

Note: For research use only, not for use in diagnostic procedure.

Extra Notes: Western blot analysis of TREM2 in various cell lines lysates using TREM2 antibody., Immunohistochemistry analysis of paraffin-embedded Human tonsil using TREM2 antibody. High-pressure and temperature Sodium Citrate pH 6.0 was used for antigen retrieval., Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using TREM2 antibody. High-pressure and temperature Sodium Citrate pH 6.0 was used for antigen retrieval., Immunohistochemistry analysis of paraffin-embedded Human gastric cancer using TREM2 antibody. High-pressure and temperature Sodium Citrate pH 6.0 was used for antigen retrieval.

Alternative Name: TREM2; TREM-2; Trem2a; Trem2b; Trem2c; triggering receptor expressed on myeloid cells 2

Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human TREM2 (NP_061838.1).HNTt VFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSIS

Conjugate: Unconjugated

Modification: Unmodified

TREM2 Polyclonal Antibody-BZ17066

Item no : 57412091241
sold recently : Login >>
US$ 171.29
Pay in 4 interest-free payments of $42.82 Learn more
Min. order: 1piece

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 25 - Sep 30

Enjoy 20% off shipping

US$ 171.29

1-11

US$ 154.16

12-35

US$ 119.90

36-59

US$ 102.77

60+

US$40

Get now

Sign up to your membership to get coupons up to

15%

Get now

Opportunity to enjoy order discount up to 15% off

Please add the products
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

recommand products

Related Searches